PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT08681
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 258aa    MW: 29153.6 Da    PI: 7.2905
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT08681genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.55.7e-12142188147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g WT+ E+ l++++    G g Wk I++++ + Rt+ q+ s+ qky
         EMT08681 142 KGFWTPNEHRLFLHGLSVCGHGKWKDISKHFVTSRTPTQISSHAQKY 188
                      688*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.197137193IPR017930Myb domain
SuperFamilySSF466895.67E-16140194IPR009057Homeodomain-like
SMARTSM007174.6E-8141191IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-11142188IPR009057Homeodomain-like
PfamPF002493.7E-9143188IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.9E-12144191IPR006447Myb domain, plants
CDDcd001671.90E-7145189No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MNPRVNQEWT PSEVEGARSI IDGLNNNYYN DGTSHGKNKK HEMMDKLQTW FPRKSMQQCP  60
KKECHVTNSD HGVNYTVDGP VSKNFGLQEE AAMEGTDFLF GCPLDIRQTM DSQEEVPTVE  120
PNKVVLENKT CIHQPVLAPR AKGFWTPNEH RLFLHGLSVC GHGKWKDISK HFVTSRTPTQ  180
ISSHAQKYFM RLKSKGSGSQ RYSINDVELD DANPWKMENS FNFCQALALQ STVGANNQNS  240
SFDLQTASSP FVTMNNIP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752587.17e-68PREDICTED: uncharacterized protein LOC100829132
TrEMBLM8B3Y30.0M8B3Y3_AEGTA; Myb-like protein J
STRINGMLOC_16598.11e-130(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.12e-20MYB family protein